Lineage for d1regy_ (1reg Y:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80746Superfamily d.58.27: Translational regulator protein regA [55064] (1 family) (S)
  5. 80747Family d.58.27.1: Translational regulator protein regA [55065] (1 protein)
  6. 80748Protein Translational regulator protein regA [55066] (1 species)
  7. 80749Species Bacteriophage T4 [TaxId:10665] [55067] (1 PDB entry)
  8. 80751Domain d1regy_: 1reg Y: [39407]

Details for d1regy_

PDB Entry: 1reg (more details), 1.9 Å

PDB Description: crystal structure of the t4 rega translational regulator protein at 1.9 angstroms resolution

SCOP Domain Sequences for d1regy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1regy_ d.58.27.1 (Y:) Translational regulator protein regA {Bacteriophage T4}
mieitlkkpedflkvketltrmgiannkdkvlyqschilqkkglyyivhfkemlrmdgrq
vemteedevrrdsiawlledwglieivpgqrtfmkdltnnfrvisfkqkhewklvpkyti

SCOP Domain Coordinates for d1regy_:

Click to download the PDB-style file with coordinates for d1regy_.
(The format of our PDB-style files is described here.)

Timeline for d1regy_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1regx_