Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (28 species) not a true protein |
Species Ovis aries [TaxId:9940] [393976] (17 PDB entries) |
Domain d6zkax_: 6zka X: [394068] automated match to d2qnwa_ complexed with 3pe, amp, cdl, dcq, myr, pc1, zmp |
PDB Entry: 6zka (more details), 2.5 Å
SCOPe Domain Sequences for d6zkax_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zkax_ a.28.1.0 (X:) automated matches {Ovis aries [TaxId: 9940]} dappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfe ipdidaeklmcpqeivdyiadkkdvye
Timeline for d6zkax_: