SCOPe 2.07: Domain d6zknj_: 6zkn j:

Lineage for d6zknj_ (6zkn j:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (28 species)
   not a true protein

7. Species Ovis aries [TaxId:9940] [393976] (17 PDB entries)

8. Domain d6zknj_: 6zkn j: [394044]
   automated match to d2qnwa_
   complexed with 3pe, 970, amp, cdl, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn

Details for d6zknj_

PDB Entry: 6zkn, 2.9 Å

PDB Description: complex i inhibited by rotenone, open3

PDB Compounds: (j:) Acyl carrier protein

SCOPe Domain Sequences for d6zknj_:

Sequence; same for both SEQRES and ATOM records:

>d6zknj_ a.28.1.0 (j:) automated matches {Ovis aries [TaxId: 9940]}
pltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfeipd
idaeklmcpqeivdyiadkkdv

Timeline for d6zknj_:

• d6zknj_ is new in SCOPe 2.07-stable
  
• d6zknj_ appears in the current release, SCOPe 2.08