Lineage for d1fwlc2 (1fwl C:168-300)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412999Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 413000Family d.58.26.1: Homoserine kinase [55061] (1 protein)
  6. 413001Protein Homoserine kinase [55062] (1 species)
  7. 413002Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 413015Domain d1fwlc2: 1fwl C:168-300 [39404]
    Other proteins in same PDB: d1fwla1, d1fwlb1, d1fwlc1, d1fwld1

Details for d1fwlc2

PDB Entry: 1fwl (more details), 2.25 Å

PDB Description: crystal structure of homoserine kinase

SCOP Domain Sequences for d1fwlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwlc2 d.58.26.1 (C:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOP Domain Coordinates for d1fwlc2:

Click to download the PDB-style file with coordinates for d1fwlc2.
(The format of our PDB-style files is described here.)

Timeline for d1fwlc2: