SCOPe 2.07: Domain d6zjkc1: 6zjk C:1-315

Lineage for d6zjkc1 (6zjk C:1-315)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (58 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:498214] [394031] (1 PDB entry)

8. Domain d6zjkc1: 6zjk C:1-315 [394037]
   Other proteins in same PDB: d6zjka2, d6zjkb2, d6zjkc2
   automated match to d2o1za_
   complexed with fe, gol

Details for d6zjkc1

PDB Entry: 6zjk, 2 Å

PDB Description: ribonucleotide reductase r2 subunit from clostridium botulinum

PDB Compounds: (C:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d6zjkc1:

Sequence; same for both SEQRES and ATOM records:

>d6zjkc1 a.25.1.0 (C:1-315) automated matches {Clostridium botulinum [TaxId: 498214]}
mlkkmifnekgqrgtesmingnttnlrewnrikyswasdfyrtmlnnfwipeeislnedi
kqfpyltdgernafdkiisflnfldsvqsenlpnisryitaaevssllniqtfqeeihaq
sysyildtvtnpitrdkiydqwredehllernkfiagiyekfnkepeihnflraimanyi
legiyfysgfsffytlarqgkmtatstifkyinrdevthlvlfqniikelknenshifte
eleeefrqmmrmgveheiqwgqyvtnneilglndelieryikylsnlrlvaiglkplype
inkhpmewidgfskl

Timeline for d6zjkc1:

• d6zjkc1 is new in SCOPe 2.07-stable
  
• d6zjkc1 appears in the current release, SCOPe 2.08