![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.26.1: Homoserine kinase [55061] (1 protein) |
![]() | Protein Homoserine kinase [55062] (1 species) |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries) |
![]() | Domain d1fwkd2: 1fwk D:168-300 [39401] Other proteins in same PDB: d1fwka1, d1fwkb1, d1fwkc1, d1fwkd1 CASP4 complexed with adp, mg |
PDB Entry: 1fwk (more details), 2.1 Å
SCOP Domain Sequences for d1fwkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fwkd2 d.58.26.1 (D:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen tirtevgkgvevv
Timeline for d1fwkd2: