SCOPe 2.08: Domain d6zgzd2: 6zgz D:217-392

Lineage for d6zgzd2 (6zgz D:217-392)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.7: Galactokinase [103011] (2 proteins)

6. Protein automated matches [362873] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [362874] (16 PDB entries)

8. Domain d6zgzd2: 6zgz D:217-392 [394005]
   Other proteins in same PDB: d6zgza1, d6zgzb1, d6zgzd1, d6zgze1
   automated match to d1wuua2
   complexed with gal, hfk, ssy

Details for d6zgzd2

PDB Entry: 6zgz, 2.3 Å

PDB Description: structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide

PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d6zgzd2:

Sequence; same for both SEQRES and ATOM records:

>d6zgzd2 d.58.26.7 (D:217-392) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhslasseypvrrrqceevaralgaaslrevqleeleaardlvskegfr
rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp
gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

Timeline for d6zgzd2:

• d6zgzd2 first appeared in SCOPe 2.07