Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (29 species) not a true protein |
Species Sheep (Ovis aries) [TaxId:9940] [393976] (17 PDB entries) |
Domain d6zkfx_: 6zkf X: [394001] Other proteins in same PDB: d6zkf11, d6zkf12, d6zkf13, d6zkfg_ automated match to d2qnwa_ complexed with 3pe, amp, cdl, dcq, fes, fmn, k, myr, nai, ndp, pc1, sf4, zmp, zn |
PDB Entry: 6zkf (more details), 2.8 Å
SCOPe Domain Sequences for d6zkfx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zkfx_ a.28.1.0 (X:) automated matches {Sheep (Ovis aries) [TaxId: 9940]} dappltlegikdrvlyvlklydkidpeklsvnshfmkdlgldsldqveiimamedefgfe ipdidaeklmcpqeivdyiadkkdvye
Timeline for d6zkfx_: