SCOP 1.63: Domain d1fwkc2: 1fwk C:168-300

Lineage for d1fwkc2 (1fwk C:168-300)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase [55060] (4 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.1: Homoserine kinase, C-terminal domain [55061] (1 protein)

6. Protein Homoserine kinase, C-terminal domain [55062] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)

8. Domain d1fwkc2: 1fwk C:168-300 [39400]
   Other proteins in same PDB: d1fwka1, d1fwkb1, d1fwkc1, d1fwkd1

Details for d1fwkc2

PDB Entry: 1fwk, 2.1 Å

PDB Description: crystal structure of homoserine kinase complexed with adp

SCOP Domain Sequences for d1fwkc2:

Sequence; same for both SEQRES and ATOM records:

>d1fwkc2 d.58.26.1 (C:168-300) Homoserine kinase, C-terminal domain {Archaeon Methanococcus jannaschii}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

Timeline for d1fwkc2:

• d1fwkc2 first appeared (with stable ids) in SCOP 1.55
  
• d1fwkc2 appears in SCOP 1.61
  
• d1fwkc2 appears in SCOP 1.65
  
• d1fwkc2 appears in the current release, SCOPe 2.08