Lineage for d1fwkc2 (1fwk C:168-300)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257962Superfamily d.58.26: GHMP Kinase [55060] (4 families) (S)
    common fold is elaborated with additional secondary structures
  5. 257963Family d.58.26.1: Homoserine kinase, C-terminal domain [55061] (1 protein)
  6. 257964Protein Homoserine kinase, C-terminal domain [55062] (1 species)
  7. 257965Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 257974Domain d1fwkc2: 1fwk C:168-300 [39400]
    Other proteins in same PDB: d1fwka1, d1fwkb1, d1fwkc1, d1fwkd1

Details for d1fwkc2

PDB Entry: 1fwk (more details), 2.1 Å

PDB Description: crystal structure of homoserine kinase complexed with adp

SCOP Domain Sequences for d1fwkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwkc2 d.58.26.1 (C:168-300) Homoserine kinase, C-terminal domain {Archaeon Methanococcus jannaschii}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOP Domain Coordinates for d1fwkc2:

Click to download the PDB-style file with coordinates for d1fwkc2.
(The format of our PDB-style files is described here.)

Timeline for d1fwkc2: