Lineage for d1fwka2 (1fwk A:168-300)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561426Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561427Family d.58.26.1: Homoserine kinase [55061] (1 protein)
  6. 2561428Protein Homoserine kinase [55062] (1 species)
  7. 2561429Species Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)
  8. 2561440Domain d1fwka2: 1fwk A:168-300 [39398]
    Other proteins in same PDB: d1fwka1, d1fwkb1, d1fwkc1, d1fwkd1
    CASP4
    complexed with adp, mg

Details for d1fwka2

PDB Entry: 1fwk (more details), 2.1 Å

PDB Description: crystal structure of homoserine kinase complexed with adp
PDB Compounds: (A:) homoserine kinase

SCOPe Domain Sequences for d1fwka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwka2 d.58.26.1 (A:168-300) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

SCOPe Domain Coordinates for d1fwka2:

Click to download the PDB-style file with coordinates for d1fwka2.
(The format of our PDB-style files is described here.)

Timeline for d1fwka2: