SCOPe 2.08: Domain d6zgxe2: 6zgx E:217-392

Lineage for d6zgxe2 (6zgx E:217-392)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
common fold is elaborated with additional secondary structures
Family d.58.26.7: Galactokinase [103011] (2 proteins)
Protein automated matches [362873] (1 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [362874] (16 PDB entries)
Domain d6zgxe2: 6zgx E:217-392 [393952]
Other proteins in same PDB: d6zgxa1, d6zgxb1, d6zgxd1, d6zgxe1
automated match to d1wuua2
complexed with gal, hfk, s6v

Details for d6zgxe2

PDB Entry: 6zgx (more details), 1.86 Å

PDB Description: structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide

PDB Compounds: (E:) Galactokinase

SCOPe Domain Sequences for d6zgxe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zgxe2 d.58.26.7 (E:217-392) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhslasseypvrrrqceevaralgaaslrevqleeleaardlvskegfr
rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp
gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

SCOPe Domain Coordinates for d6zgxe2:

Click to download the PDB-style file with coordinates for d6zgxe2.
(The format of our PDB-style files is described here.)

Timeline for d6zgxe2: