SCOPe 2.08: Domain d6zgxe1: 6zgx E:2-216

Lineage for d6zgxe1 (6zgx E:2-216)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)

6. Protein automated matches [232306] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [362871] (16 PDB entries)

8. Domain d6zgxe1: 6zgx E:2-216 [393951]
   Other proteins in same PDB: d6zgxa2, d6zgxb2, d6zgxd2, d6zgxe2
   automated match to d1wuua1
   complexed with gal, hfk, s6v

Details for d6zgxe1

PDB Entry: 6zgx, 1.86 Å

PDB Description: structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide

PDB Compounds: (E:) Galactokinase

SCOPe Domain Sequences for d6zgxe1:

Sequence; same for both SEQRES and ATOM records:

>d6zgxe1 d.14.1.5 (E:2-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt
vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap
lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp
cgimdqfislmgqkghallidcrsletslvplsdp

Timeline for d6zgxe1:

• d6zgxe1 first appeared in SCOPe 2.07