Lineage for d6y1132 (6y11 3:96-246)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556327Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 2556328Protein automated matches [229599] (4 species)
    not a true protein
  7. 2556376Species Thermus thermophilus [TaxId:274] [393541] (1 PDB entry)
  8. 2556377Domain d6y1132: 6y11 3:96-246 [393940]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11w_, d6y11x_
    automated match to d2fug34
    complexed with fes, fmn, sf4

Details for d6y1132

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (3:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d6y1132:

Sequence, based on SEQRES records: (download)

>d6y1132 d.58.1.0 (3:96-246) automated matches {Thermus thermophilus [TaxId: 274]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvyt
rfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmd
fglpsgfsgnitdicpvgalldltarfrarn

Sequence, based on observed residues (ATOM records): (download)

>d6y1132 d.58.1.0 (3:96-246) automated matches {Thermus thermophilus [TaxId: 274]}
lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyplelpvytrfef
trrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmdfglp
sgfsgnitdicpvgalldltarfrarn

SCOPe Domain Coordinates for d6y1132:

Click to download the PDB-style file with coordinates for d6y1132.
(The format of our PDB-style files is described here.)

Timeline for d6y1132: