Lineage for d6zeep1 (6zee P:7-299)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998162Protein Protein phosphatase-1 (PP-1) [56311] (6 species)
  7. 2998184Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries)
    Uniprot P37140 1-308
  8. 2998192Domain d6zeep1: 6zee P:7-299 [393917]
    Other proteins in same PDB: d6zeea2, d6zeeb2, d6zeei2, d6zeek2, d6zeep2, d6zeeq2
    automated match to d1s70a_
    complexed with 16p, edo, gol, mn, so4

Details for d6zeep1

PDB Entry: 6zee (more details), 1.9 Å

PDB Description: structure of pp1(7-300) bound to phactr1 (507-580) at ph8.4
PDB Compounds: (P:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d6zeep1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zeep1 d.159.1.3 (P:7-299) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d6zeep1:

Click to download the PDB-style file with coordinates for d6zeep1.
(The format of our PDB-style files is described here.)

Timeline for d6zeep1: