Lineage for d6zgxd2 (6zgx D:217-392)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954566Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954628Family d.58.26.7: Galactokinase [103011] (2 proteins)
  6. 2954647Protein automated matches [362873] (1 species)
    not a true protein
  7. 2954648Species Human (Homo sapiens) [TaxId:9606] [362874] (16 PDB entries)
  8. 2954651Domain d6zgxd2: 6zgx D:217-392 [393912]
    Other proteins in same PDB: d6zgxa1, d6zgxb1, d6zgxd1, d6zgxe1
    automated match to d1wuua2
    complexed with gal, hfk, s6v

Details for d6zgxd2

PDB Entry: 6zgx (more details), 1.86 Å

PDB Description: structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide
PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d6zgxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zgxd2 d.58.26.7 (D:217-392) automated matches {Human (Homo sapiens) [TaxId: 9606]}
klavlitnsnvrhslasseypvrrrqceevaralgaaslrevqleeleaardlvskegfr
rarhvvgeirrtaqaaaalrrgdyrafgrlmveshrslrddyevscpeldqlveaalavp
gvygsrmtgggfggctvtlleasaaphamrhiqehyggtatfylsqaadgakvlcl

SCOPe Domain Coordinates for d6zgxd2:

Click to download the PDB-style file with coordinates for d6zgxd2.
(The format of our PDB-style files is described here.)

Timeline for d6zgxd2: