![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [385346] (2 PDB entries) |
![]() | Domain d6z1fc1: 6z1f C:13-150 [393879] Other proteins in same PDB: d6z1fa2, d6z1fb2, d6z1fc2, d6z1fd2, d6z1fe2, d6z1ff2, d6z1fg2, d6z1fh2, d6z1fi_, d6z1fj_, d6z1fk_, d6z1fl_, d6z1fm_, d6z1fn_, d6z1fo_, d6z1fp_ automated match to d1ir2u2 complexed with adp, ags, cap, mg |
PDB Entry: 6z1f (more details), 2.86 Å
SCOPe Domain Sequences for d6z1fc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z1fc1 d.58.9.0 (C:13-150) automated matches {Nostoc sp. [TaxId: 103690]} gykagvqdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt dlltdldrykgrcydiepvpgednqfiayiaypldlfeegsitnvltsivgnvfgfkalr alrledirfpvayiktfq
Timeline for d6z1fc1: