SCOPe 2.08: Domain d6z9oa_: 6z9o A:

Lineage for d6z9oa_ (6z9o A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:882] [197352] (21 PDB entries)

8. Domain d6z9oa_: 6z9o A: [393869]
   Other proteins in same PDB: d6z9ob_
   automated match to d5jska_
   complexed with 6ml, fco, fe2, gol, h2s, ni, oxy, sf4

Details for d6z9oa_

PDB Entry: 6z9o, 1.53 Å

PDB Description: structure of [nifese] hydrogenase g491s variant from desulfovibrio vulgaris hildenborough pressurized with oxygen gas - structure g491a- o2-ld

PDB Compounds: (A:) periplasmic [nifese] hydrogenase, small subunit

SCOPe Domain Sequences for d6z9oa_:

Sequence; same for both SEQRES and ATOM records:

>d6z9oa_ e.19.1.1 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
gerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaiehmrkv
aekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgtcaay
ggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkngleg
glaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckgpmtm
adcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa

Timeline for d6z9oa_:

• d6z9oa_ first appeared in SCOPe 2.07