Lineage for d6z20d_ (6z20 D:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (24 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) 
Domain d6z20d_: 6z20 D: [393839]
automated match to d1igmh_
complexed with cl, gol
Details for d6z20d_
PDB Entry: 6z20 (more details), 2.68 Å
PDB Description: structure of the ec2 domain of cd9 in complex with nanobody 4c8
PDB Compounds: (D:) Nanobody 4C8SCOPe Domain Sequences for d6z20d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z20d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscaasgrtfsdyvmgwfrqapgkertfvarigwsgdltyya
dsvkgrftisrdnakntvylqmnslkpedtaiyycaaderwgtggkfdywgqgtqvtvss
SCOPe Domain Coordinates for d6z20d_:
Click to download the PDB-style file with coordinates for d6z20d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6z20d_:
- d6z20d_ first appeared in SCOPe 2.07
View in 3D
