SCOPe 2.08: Domain d6z1za_: 6z1z A:

Lineage for d6z1za_ (6z1z A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6z1za_: 6z1z A: [393822]
   automated match to d1igmh_

Details for d6z1za_

PDB Entry: 6z1z, 1.7 Å

PDB Description: structure of the anti-cd9 nanobody 4c8

PDB Compounds: (A:) Nanobody 4C8

SCOPe Domain Sequences for d6z1za_:

Sequence, based on SEQRES records:

>d6z1za_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqaggslrlscaasgrtfsdyvmgwfrqapgkertfvarigwsgdltyy
adsvkgrftisrdnakntvylqmnslkpedtaiyycaaderwgtggkfdywgqgtqvtvs
s

Sequence, based on observed residues (ATOM records):

>d6z1za_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqaggslrlscaasgrtfsdyvmgwfrqapgkertfvarigwsgdltyy
adsvkgrftisrdnakntvylqmnslkpedtaiyycaaderwgkfdywgqgtqvtvss

Timeline for d6z1za_:

• d6z1za_ first appeared in SCOPe 2.07