![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
![]() | Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
![]() | Family d.73.1.0: automated matches [336551] (1 protein) not a true family |
![]() | Protein automated matches [336552] (9 species) not a true protein |
![]() | Species Nostoc sp. [TaxId:103690] [393795] (1 PDB entry) |
![]() | Domain d6z1fk_: 6z1f K: [393817] Other proteins in same PDB: d6z1fa1, d6z1fa2, d6z1fb1, d6z1fb2, d6z1fc1, d6z1fc2, d6z1fd1, d6z1fd2, d6z1fe1, d6z1fe2, d6z1ff1, d6z1ff2, d6z1fg1, d6z1fg2, d6z1fh1, d6z1fh2 automated match to d8ruci_ complexed with adp, ags, cap, mg |
PDB Entry: 6z1f (more details), 2.86 Å
SCOPe Domain Sequences for d6z1fk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z1fk_ d.73.1.0 (K:) automated matches {Nostoc sp. [TaxId: 103690]} mqtlpkerryetlsylppltdvqiekqvqyilsqgyipavefnevseptelywtlwklpl fgaktsrevlaevqscrsqypghyirvvgfdnikqcqilsfivhkpsr
Timeline for d6z1fk_: