SCOPe 2.08: Domain d6z3qc_: 6z3q C:

Lineage for d6z3qc_ (6z3q C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [195913] (16 PDB entries)

8. Domain d6z3qc_: 6z3q C: [393816]
   Other proteins in same PDB: d6z3qa_, d6z3qb_, d6z3qh_, d6z3ql_
   automated match to d3zfec_
   complexed with sph

Details for d6z3qc_

PDB Entry: 6z3q, 2.7 Å

PDB Description: structure of ev71 in complex with a protective antibody 38-1-10a fab

PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d6z3qc_:

Sequence; same for both SEQRES and ATOM records:

>d6z3qc_ b.121.4.1 (C:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
natslmerlrfpvsaqagkgelcavfradpgrdgpwqstmlgqlcgyytqwsgslevtfm
ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmklckdtshilqtas
iq

Timeline for d6z3qc_:

• d6z3qc_ first appeared in SCOPe 2.07