Lineage for d6z1fg2 (6z1f G:151-476)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838817Species Nostoc sp. [TaxId:103690] [385348] (2 PDB entries)
  8. 2838824Domain d6z1fg2: 6z1f G:151-476 [393810]
    Other proteins in same PDB: d6z1fa1, d6z1fb1, d6z1fc1, d6z1fd1, d6z1fe1, d6z1ff1, d6z1fg1, d6z1fh1, d6z1fi_, d6z1fj_, d6z1fk_, d6z1fl_, d6z1fm_, d6z1fn_, d6z1fo_, d6z1fp_
    automated match to d1ir2a1
    complexed with adp, ags, cap, mg

Details for d6z1fg2

PDB Entry: 6z1f (more details), 2.86 Å

PDB Description: cryoem structure of rubisco activase with its substrate rubisco from nostoc sp. (strain pcc7120)
PDB Compounds: (G:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6z1fg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z1fg2 c.1.14.1 (G:151-476) automated matches {Nostoc sp. [TaxId: 103690]}
gpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddeninsa
pfqrwrdrflfvadaitkaqaetgeikghylnvtaptceemlkraeyakelkqpiimhdy
ltagftanttlarwcrdngvllhihramhavidrqknhgihfrvlakalrlsggdhihtg
tvvgklegergitmgfvdllrenyveqdksrgiyftqdwaslpgvmavasggihvwhmpa
lveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrnlaregndvireaa
kwspelavacelwkeikfefeamdtv

SCOPe Domain Coordinates for d6z1fg2:

Click to download the PDB-style file with coordinates for d6z1fg2.
(The format of our PDB-style files is described here.)

Timeline for d6z1fg2: