Lineage for d1eksa_ (1eks A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954453Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 2954454Family d.58.21.1: Molybdenum cofactor biosynthesis protein C, MoaC [55041] (1 protein)
    automatically mapped to Pfam PF01967
  6. 2954455Protein Molybdenum cofactor biosynthesis protein C, MoaC [55042] (1 species)
  7. 2954456Species Escherichia coli [TaxId:562] [55043] (2 PDB entries)
  8. 2954458Domain d1eksa_: 1eks A: [39381]
    complexed with tla

Details for d1eksa_

PDB Entry: 1eks (more details), 2.5 Å

PDB Description: asp128ala variant of moac protein from e. coli
PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d1eksa_:

Sequence, based on SEQRES records: (download)

>d1eksa_ d.58.21.1 (A:) Molybdenum cofactor biosynthesis protein C, MoaC {Escherichia coli [TaxId: 562]}
mvdvsakaetvrearaeafvtmrsetlamiidgrhhkgdvfatariagiqaakrtwdlip
lchplmlskvevnlqaepehnrvrietlcrltgktgvemealtaasvaaltiyamckavq
kdmvigpvrllaksggksgdfk

Sequence, based on observed residues (ATOM records): (download)

>d1eksa_ d.58.21.1 (A:) Molybdenum cofactor biosynthesis protein C, MoaC {Escherichia coli [TaxId: 562]}
mvdvsakaetvrearaeafvtmrsetlamiidgrhhkgdvfatariagiqaakrtwdlip
lchplmlskvevnlqaepehnrvrietlcrltgktgvemealtaasvaaltiyamckavq
kdmvigpvrllaksksgdfk

SCOPe Domain Coordinates for d1eksa_:

Click to download the PDB-style file with coordinates for d1eksa_.
(The format of our PDB-style files is described here.)

Timeline for d1eksa_: