Lineage for d6z1fj_ (6z1f J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957953Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2957954Protein automated matches [336552] (9 species)
    not a true protein
  7. 2957964Species Nostoc sp. [TaxId:103690] [393795] (1 PDB entry)
  8. 2957966Domain d6z1fj_: 6z1f J: [393799]
    Other proteins in same PDB: d6z1fa1, d6z1fa2, d6z1fb1, d6z1fb2, d6z1fc1, d6z1fc2, d6z1fd1, d6z1fd2, d6z1fe1, d6z1fe2, d6z1ff1, d6z1ff2, d6z1fg1, d6z1fg2, d6z1fh1, d6z1fh2
    automated match to d8ruci_
    complexed with adp, ags, cap, mg

Details for d6z1fj_

PDB Entry: 6z1f (more details), 2.86 Å

PDB Description: cryoem structure of rubisco activase with its substrate rubisco from nostoc sp. (strain pcc7120)
PDB Compounds: (J:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d6z1fj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z1fj_ d.73.1.0 (J:) automated matches {Nostoc sp. [TaxId: 103690]}
mqtlpkerryetlsylppltdvqiekqvqyilsqgyipavefnevseptelywtlwklpl
fgaktsrevlaevqscrsqypghyirvvgfdnikqcqilsfivhkpsr

SCOPe Domain Coordinates for d6z1fj_:

Click to download the PDB-style file with coordinates for d6z1fj_.
(The format of our PDB-style files is described here.)

Timeline for d6z1fj_: