SCOPe 2.08: Domain d1qayb1: 1qay B:611-720

Lineage for d1qayb1 (1qay B:611-720)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
   Uniprot P13702 4-377

8. Domain d1qayb1: 1qay B:611-720 [39379]
   Other proteins in same PDB: d1qaya2, d1qayb2
   complexed with mev, nad

Details for d1qayb1

PDB Entry: 1qay, 2.8 Å

PDB Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with mevalonate and nad+

PDB Compounds: (B:) protein (3-hydroxy-3-methylglutaryl-coenzyme a reductase)

SCOPe Domain Sequences for d1qayb1:

Sequence; same for both SEQRES and ATOM records:

>d1qayb1 d.58.20.1 (B:611-720) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

Timeline for d1qayb1:

• d1qayb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qayb1 appears in SCOPe 2.07