Lineage for d6z1ff1 (6z1f F:13-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953121Species Nostoc sp. [TaxId:103690] [385346] (2 PDB entries)
  8. 2953127Domain d6z1ff1: 6z1f F:13-150 [393789]
    Other proteins in same PDB: d6z1fa2, d6z1fb2, d6z1fc2, d6z1fd2, d6z1fe2, d6z1ff2, d6z1fg2, d6z1fh2, d6z1fi_, d6z1fj_, d6z1fk_, d6z1fl_, d6z1fm_, d6z1fn_, d6z1fo_, d6z1fp_
    automated match to d1ir2u2
    complexed with adp, ags, cap, mg

Details for d6z1ff1

PDB Entry: 6z1f (more details), 2.86 Å

PDB Description: cryoem structure of rubisco activase with its substrate rubisco from nostoc sp. (strain pcc7120)
PDB Compounds: (F:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6z1ff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z1ff1 d.58.9.0 (F:13-150) automated matches {Nostoc sp. [TaxId: 103690]}
gykagvqdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt
dlltdldrykgrcydiepvpgednqfiayiaypldlfeegsitnvltsivgnvfgfkalr
alrledirfpvayiktfq

SCOPe Domain Coordinates for d6z1ff1:

Click to download the PDB-style file with coordinates for d6z1ff1.
(The format of our PDB-style files is described here.)

Timeline for d6z1ff1: