Lineage for d1qaxb1 (1qax B:611-720)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863430Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 863431Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 863432Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 863470Species Pseudomonas mevalonii [TaxId:32044] [55039] (5 PDB entries)
    Uniprot P13702 4-377
  8. 863480Domain d1qaxb1: 1qax B:611-720 [39377]
    Other proteins in same PDB: d1qaxa2, d1qaxb2
    complexed with hmg, nad

Details for d1qaxb1

PDB Entry: 1qax (more details), 2.8 Å

PDB Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with hmg- coa and nad+
PDB Compounds: (B:) protein (3-hydroxy-3-methylglutaryl-coenzyme a reductase)

SCOP Domain Sequences for d1qaxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qaxb1 d.58.20.1 (B:611-720) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

SCOP Domain Coordinates for d1qaxb1:

Click to download the PDB-style file with coordinates for d1qaxb1.
(The format of our PDB-style files is described here.)

Timeline for d1qaxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qaxb2