Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) |
Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein) |
Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species) |
Species Pseudomonas mevalonii [TaxId:32044] [55039] (5 PDB entries) |
Domain d1qaxb1: 1qax B:611-720 [39377] Other proteins in same PDB: d1qaxa2, d1qaxb2 complexed with hmg, nad |
PDB Entry: 1qax (more details), 2.8 Å
SCOP Domain Sequences for d1qaxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qaxb1 d.58.20.1 (B:611-720) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]} lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl
Timeline for d1qaxb1: