Lineage for d6ymxl1 (6ymx L:27-239)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611059Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2611301Protein automated matches [254430] (2 species)
    not a true protein
  7. 2611302Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257462] (3 PDB entries)
  8. 2611307Domain d6ymxl1: 6ymx L:27-239 [393761]
    Other proteins in same PDB: d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
    automated match to d3cx5a1
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxl1

PDB Entry: 6ymx (more details), 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae
PDB Compounds: (L:) Cytochrome b-c1 complex subunit 1, mitochondrial

SCOPe Domain Sequences for d6ymxl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymxl1 d.185.1.1 (L:27-239) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
qvqdfeendhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
vvvgtgnikhedlvnsiesknlslqtgtkpvlk

SCOPe Domain Coordinates for d6ymxl1:

Click to download the PDB-style file with coordinates for d6ymxl1.
(The format of our PDB-style files is described here.)

Timeline for d6ymxl1: