Lineage for d1qaxa1 (1qax A:111-220)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197354Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 2197355Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 2197356Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 2197394Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
    Uniprot P13702 4-377
  8. 2197411Domain d1qaxa1: 1qax A:111-220 [39376]
    Other proteins in same PDB: d1qaxa2, d1qaxb2
    complexed with hmg, nad

Details for d1qaxa1

PDB Entry: 1qax (more details), 2.8 Å

PDB Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with hmg- coa and nad+
PDB Compounds: (A:) protein (3-hydroxy-3-methylglutaryl-coenzyme a reductase)

SCOPe Domain Sequences for d1qaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qaxa1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

SCOPe Domain Coordinates for d1qaxa1:

Click to download the PDB-style file with coordinates for d1qaxa1.
(The format of our PDB-style files is described here.)

Timeline for d1qaxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qaxa2