SCOP 1.57: Domain d1qaxa1: 1qax A:111-220

Lineage for d1qaxa1 (1qax A:111-220)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family)

5. Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)

6. Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)

7. Species Pseudomonas mevalonii [TaxId:32044] [55039] (2 PDB entries)

8. Domain d1qaxa1: 1qax A:111-220 [39376]
   Other proteins in same PDB: d1qaxa2, d1qaxb2

Details for d1qaxa1

PDB Entry: 1qax, 2.8 Å

PDB Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with hmg- coa and nad+

SCOP Domain Sequences for d1qaxa1:

Sequence; same for both SEQRES and ATOM records:

>d1qaxa1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl

Timeline for d1qaxa1:

• d1qaxa1 first appeared (with stable ids) in SCOP 1.55
  
• d1qaxa1 appears in SCOP 1.59
  
• d1qaxa1 appears in the current release, SCOPe 2.08