![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) ![]() |
![]() | Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein) |
![]() | Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species) |
![]() | Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries) Uniprot P13702 4-377 |
![]() | Domain d1qaxa1: 1qax A:111-220 [39376] Other proteins in same PDB: d1qaxa2, d1qaxb2 complexed with hmg, nad |
PDB Entry: 1qax (more details), 2.8 Å
SCOPe Domain Sequences for d1qaxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qaxa1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]} lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl
Timeline for d1qaxa1: