SCOPe 2.07: Domain d6y117_: 6y11 7:

Lineage for d6y117_ (6y11 7:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families)

5. Family d.82.2.2: Nqo15-like [143572] (1 protein)
   overall structural similarity to the frataxin-like family
   automatically mapped to Pfam PF11497

6. Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143574] (5 PDB entries)
   Uniprot Q5SKZ7 3-129

8. Domain d6y117_: 6y11 7: [393719]
   Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11w_, d6y11x_
   automated match to d3iam7_
   complexed with fes, fmn, sf4

Details for d6y117_

PDB Entry: 6y11, 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus

PDB Compounds: (7:) NADH-quinone oxidoreductase subunit 15

SCOPe Domain Sequences for d6y117_:

Sequence; same for both SEQRES and ATOM records:

>d6y117_ d.82.2.2 (7:) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]}
asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
realafa

Timeline for d6y117_:

• d6y117_ is new in SCOPe 2.07-stable
  
• d6y117_ appears in the current release, SCOPe 2.08