SCOPe 2.07: Domain d6yj4u_: 6yj4 U:

Lineage for d6yj4u_ (6yj4 U:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (28 species)
   not a true protein

7. Species Yarrowia lipolytica [TaxId:4952] [393676] (1 PDB entry)

8. Domain d6yj4u_: 6yj4 U: [393705]
   automated match to d2lola_
   complexed with 3pe, cdl, ehz, fes, fmn, lmt, ndp, plc, sf4, zn

Details for d6yj4u_

PDB Entry: 6yj4, 2.7 Å

PDB Description: structure of yarrowia lipolytica complex i at 2.7 a

PDB Compounds: (U:) Acyl carrier protein ACPM2 of NADH:Ubiquinone Oxidoreductase (Complex I)

SCOPe Domain Sequences for d6yj4u_:

Sequence; same for both SEQRES and ATOM records:

>d6yj4u_ a.28.1.0 (U:) automated matches {Yarrowia lipolytica [TaxId: 4952]}
ssahvltkdmiqerivallesfdkvndaknitatanltsdlgldsldvvevvmaieeefg
leipdhdadeiktvqqaidyvsaqpaav

Timeline for d6yj4u_:

• d6yj4u_ is new in SCOPe 2.07-stable
  
• d6yj4u_ appears in the current release, SCOPe 2.08