Lineage for d6ymxc_ (6ymx c:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632473Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2632474Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 2632590Family f.25.1.0: automated matches [393699] (1 protein)
    not a true family
  6. 2632591Protein automated matches [393700] (1 species)
    not a true protein
  7. 2632592Species Saccharomyces cerevisiae [TaxId:559292] [393701] (1 PDB entry)
  8. 2632593Domain d6ymxc_: 6ymx c: [393702]
    Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
    automated match to d3ag3c_
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxc_

PDB Entry: 6ymx (more details), 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae
PDB Compounds: (c:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d6ymxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymxc_ f.25.1.0 (c:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
thlersrhqqhpfhmvmpspwpivvsfallslalstaltmhgyignmnmvylalfvllts
silwfrdivaeatylgdhtmavrkginlgflmfvlsevlifaglfwayfhsamspdvtlg
acwppvgieavqptelpllntiillssgatvtyshhaliagnrnkalsgllitfwlivif
vtcqyieytnaaftisdgvygsvfyagtglhflhmvmlaamlgvnywrmrnyhltaghhv
gyettiiythvldviwlflyvvfywwgv

SCOPe Domain Coordinates for d6ymxc_:

Click to download the PDB-style file with coordinates for d6ymxc_.
(The format of our PDB-style files is described here.)

Timeline for d6ymxc_: