Lineage for d1dq8b1 (1dq8 B:587-703)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32963Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 32964Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 32965Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 32966Species Human (Homo sapiens) [TaxId:9606] [55038] (3 PDB entries)
  8. 32972Domain d1dq8b1: 1dq8 B:587-703 [39369]
    Other proteins in same PDB: d1dq8a4, d1dq8b4, d1dq8c4, d1dq8d4

Details for d1dq8b1

PDB Entry: 1dq8 (more details), 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg and coa

SCOP Domain Sequences for d1dq8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq8b1 d.58.20.1 (B:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOP Domain Coordinates for d1dq8b1:

Click to download the PDB-style file with coordinates for d1dq8b1.
(The format of our PDB-style files is described here.)

Timeline for d1dq8b1: