Lineage for d1dq8a1 (1dq8 A:587-703)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505142Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 505143Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 505144Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 505145Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)
  8. 505162Domain d1dq8a1: 1dq8 A:587-703 [39368]
    Other proteins in same PDB: d1dq8a4, d1dq8b4, d1dq8c4, d1dq8d4

Details for d1dq8a1

PDB Entry: 1dq8 (more details), 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg and coa

SCOP Domain Sequences for d1dq8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq8a1 d.58.20.1 (A:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOP Domain Coordinates for d1dq8a1:

Click to download the PDB-style file with coordinates for d1dq8a1.
(The format of our PDB-style files is described here.)

Timeline for d1dq8a1: