Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries) |
Domain d6yez3_: 6yez 3: [393678] Other proteins in same PDB: d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_, d6yezp_ automated match to d5l8r3_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yez (more details), 2.7 Å
SCOPe Domain Sequences for d6yez3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yez3_ f.43.1.0 (3:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} rplwfaskqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgav gaiapeylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfq dwakpgsmgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrla mlailgyfiqglvtgvgpyqnlldhvadpvnnnvltslkfh
Timeline for d6yez3_: