SCOPe 2.08: Domain d6yez3_: 6yez 3:

Lineage for d6yez3_ (6yez 3:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)

8. Domain d6yez3_: 6yez 3: [393678]
   Other proteins in same PDB: d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezl_, d6yezn_, d6yezp_
   automated match to d5l8r3_
   complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yez3_

PDB Entry: 6yez, 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex

PDB Compounds: (3:) Chlorophyll a-b binding protein 3, chloroplastic

SCOPe Domain Sequences for d6yez3_:

Sequence; same for both SEQRES and ATOM records:

>d6yez3_ f.43.1.0 (3:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
rplwfaskqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgav
gaiapeylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfq
dwakpgsmgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrla
mlailgyfiqglvtgvgpyqnlldhvadpvnnnvltslkfh

Timeline for d6yez3_:

• d6yez3_ first appeared in SCOPe 2.07