Lineage for d6yezn_ (6yez N:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2540891Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2541028Protein automated matches [190231] (13 species)
    not a true protein
  7. 2541085Species Pisum sativum [TaxId:3888] [393615] (2 PDB entries)
  8. 2541087Domain d6yezn_: 6yez N: [393674]
    Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezp_
    automated match to d1gaqb_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezn_

PDB Entry: 6yez (more details), 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex
PDB Compounds: (N:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d6yezn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yezn_ d.15.4.1 (N:) automated matches {Pisum sativum [TaxId: 3888]}
asykvklvtpdgtqefecpsdvyildhaeevgidlpyscragscsscagkvvggevdqsd
gsflddeqieagfvltcvayptsdvviethkeedlta

SCOPe Domain Coordinates for d6yezn_:

Click to download the PDB-style file with coordinates for d6yezn_.
(The format of our PDB-style files is described here.)

Timeline for d6yezn_: