Lineage for d6yezp_ (6yez P:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380194Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2380621Protein Plastocyanin [49507] (17 species)
  7. 2380669Species Pisum sativum [TaxId:3888] [393665] (2 PDB entries)
  8. 2380671Domain d6yezp_: 6yez P: [393666]
    Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_
    automated match to d1ag6a_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezp_

PDB Entry: 6yez (more details), 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex
PDB Compounds: (P:) plastocyanin

SCOPe Domain Sequences for d6yezp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yezp_ b.6.1.1 (P:) Plastocyanin {Pisum sativum [TaxId: 3888]}
vevllggddgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee
dllnapgetykvtltekgtykfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d6yezp_:

Click to download the PDB-style file with coordinates for d6yezp_.
(The format of our PDB-style files is described here.)

Timeline for d6yezp_: