![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Plastocyanin [49507] (17 species) |
![]() | Species Pisum sativum [TaxId:3888] [393665] (2 PDB entries) |
![]() | Domain d6yezp_: 6yez P: [393666] Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_ automated match to d1ag6a_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yez (more details), 2.7 Å
SCOPe Domain Sequences for d6yezp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yezp_ b.6.1.1 (P:) Plastocyanin {Pisum sativum [TaxId: 3888]} vevllggddgslaflpgdfsvasgeeivfknnagfphnvvfdedeipsgvdaakismsee dllnapgetykvtltekgtykfycsphqgagmvgkvtvn
Timeline for d6yezp_: