![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily) core:11 transmembrane helices |
![]() | Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) ![]() automatically mapped to Pfam PF00223 |
![]() | Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins) Photosystem I p700 chlorophyll a apoprotein a1/a2 |
![]() | Protein automated matches [236561] (7 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276242] (8 PDB entries) |
![]() | Domain d6yeza_: 6yez A: [393662] Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_, d6yezp_ automated match to d5l8ra_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yez (more details), 2.7 Å
SCOPe Domain Sequences for d6yeza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yeza_ f.29.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} pevkilvdrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhadahdfdshtsdleeis rkvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndpthirpsaqvvwpivgqeilngd vgggfrgiqitsgffqiwrasgitselqlyctaigalvfaalmlfagwfhyhkaapklvw fqdvesmlnhhlagllglgslswaghqvhvslpinqflnagvdpkeiplphefilnrdll aqlypsfaegatpfftlnwskyadfltfrggldpltgglwltdiahhhlaiailfliagh myrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsinlamlgsltiivahh myamppypylatdygtqlslfthhmwiggflivgaaahaaifmvrdydpttryndlldrv lrhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnt halapgttapgattstsltwgggdlvsvggkvallpiplgtadflvhhihaftihvtvli llkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynaisvvifh fswkmqsdvwgsindqgvvthitggnfaqssitingwlrdflwaqasqviqsygsslsay glfflgahfvwafslmflfsgrgywqeliesivwahnklkvapatqpralsivqgravgv thyllggiattwafflariiavg
Timeline for d6yeza_: