Lineage for d1dqac1 (1dqa C:587-703)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32963Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 32964Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 32965Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 32966Species Human (Homo sapiens) [TaxId:9606] [55038] (3 PDB entries)
  8. 32969Domain d1dqac1: 1dqa C:587-703 [39366]
    Other proteins in same PDB: d1dqaa4, d1dqab4, d1dqac4, d1dqad4

Details for d1dqac1

PDB Entry: 1dqa (more details), 2 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg, coa, and nadp+

SCOP Domain Sequences for d1dqac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqac1 d.58.20.1 (C:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens)}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOP Domain Coordinates for d1dqac1:

Click to download the PDB-style file with coordinates for d1dqac1.
(The format of our PDB-style files is described here.)

Timeline for d1dqac1: