Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) automatically mapped to Pfam PF01701 |
Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
Protein automated matches [276198] (4 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276201] (7 PDB entries) |
Domain d6yezj_: 6yez J: [393658] Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezn_, d6yezp_ automated match to d5l8rj_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yez (more details), 2.7 Å
SCOPe Domain Sequences for d6yezj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yezj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} mrdlktylsvapvastlwfaalagllieinrffpdaltfpff
Timeline for d6yezj_: