Lineage for d6yezj_ (6yez J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026183Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 3026208Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 3026209Protein automated matches [276198] (5 species)
    not a true protein
  7. 3026223Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries)
  8. 3026228Domain d6yezj_: 6yez J: [393658]
    Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezl_, d6yezn_, d6yezp_
    automated match to d5l8rj_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezj_

PDB Entry: 6yez (more details), 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex
PDB Compounds: (J:) PsaJ

SCOPe Domain Sequences for d6yezj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yezj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mrdlktylsvapvastlwfaalagllieinrffpdaltfpff

SCOPe Domain Coordinates for d6yezj_:

Click to download the PDB-style file with coordinates for d6yezj_.
(The format of our PDB-style files is described here.)

Timeline for d6yezj_: