SCOPe 2.08: Domain d6yezj_: 6yez J:

Lineage for d6yezj_ (6yez J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families)
   automatically mapped to Pfam PF01701

5. Family f.23.18.0: automated matches [276196] (1 protein)
   not a true family

6. Protein automated matches [276198] (5 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries)

8. Domain d6yezj_: 6yez J: [393658]
   Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezl_, d6yezn_, d6yezp_
   automated match to d5l8rj_
   complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezj_

PDB Entry: 6yez, 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex

PDB Compounds: (J:) PsaJ

SCOPe Domain Sequences for d6yezj_:

Sequence; same for both SEQRES and ATOM records:

>d6yezj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mrdlktylsvapvastlwfaalagllieinrffpdaltfpff

Timeline for d6yezj_:

• d6yezj_ first appeared in SCOPe 2.07