Lineage for d6yaca_ (6yac A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633163Species Pea (Pisum sativum) [TaxId:3888] [276242] (8 PDB entries)
  8. 2633166Domain d6yaca_: 6yac A: [393654]
    Other proteins in same PDB: d6yac1_, d6yac2_, d6yac3_, d6yac4_, d6yacc_, d6yacd_, d6yace1, d6yace2, d6yacf_, d6yacj_, d6yacn_
    automated match to d5l8ra_
    complexed with bcr, c7z, ca, chl, cl0, cla, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yaca_

PDB Entry: 6yac (more details), 2.5 Å

PDB Description: plant psi-ferredoxin supercomplex
PDB Compounds: (A:) photosystem I p700 chlorophyll a apoprotein a1

SCOPe Domain Sequences for d6yaca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yaca_ f.29.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
pevkilvdrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhadahdfdshtsdleeis
rkvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndpthirpsaqvvwpivgqeilngd
vgggfrgiqitsgffqiwrasgitselqlyctaigalvfaalmlfagwfhyhkaapklvw
fqdvesmlnhhlagllglgslswaghqvhvslpinqflnagvdpkeiplphefilnrdll
aqlypsfaegatpfftlnwskyadfltfrggldpltgglwltdiahhhlaiailfliagh
myrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsinlamlgsltiivahh
myamppypylatdygtqlslfthhmwiggflivgaaahaaifmvrdydpttryndlldrv
lrhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnt
halapgttapgattstsltwgggdlvsvggkvallpiplgtadflvhhihaftihvtvli
llkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynaisvvifh
fswkmqsdvwgsindqgvvthitggnfaqssitingwlrdflwaqasqviqsygsslsay
glfflgahfvwafslmflfsgrgywqeliesivwahnklkvapatqpralsivqgravgv
thyllggiattwafflariiavg

SCOPe Domain Coordinates for d6yaca_:

Click to download the PDB-style file with coordinates for d6yaca_.
(The format of our PDB-style files is described here.)

Timeline for d6yaca_: