Lineage for d6yezc_ (6yez C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2556026Protein automated matches [236563] (6 species)
    not a true protein
  7. 2556036Species Pea (Pisum sativum) [TaxId:3888] [276244] (8 PDB entries)
  8. 2556040Domain d6yezc_: 6yez C: [393653]
    Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_, d6yezp_
    automated match to d5l8rc_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezc_

PDB Entry: 6yez (more details), 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6yezc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yezc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

SCOPe Domain Coordinates for d6yezc_:

Click to download the PDB-style file with coordinates for d6yezc_.
(The format of our PDB-style files is described here.)

Timeline for d6yezc_: