SCOPe 2.08: Domain d6yezc_: 6yez C:

Lineage for d6yezc_ (6yez C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein automated matches [236563] (10 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276244] (9 PDB entries)

8. Domain d6yezc_: 6yez C: [393653]
   Other proteins in same PDB: d6yez1_, d6yez2_, d6yez3_, d6yez4_, d6yeza_, d6yezb_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezl_, d6yezn_, d6yezp_
   automated match to d5l8rc_
   complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d6yezc_

PDB Entry: 6yez, 2.7 Å

PDB Description: plant psi-ferredoxin-plastocyanin supercomplex

PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6yezc_:

Sequence; same for both SEQRES and ATOM records:

>d6yezc_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

Timeline for d6yezc_:

• d6yezc_ first appeared in SCOPe 2.07