Lineage for d1dqab1 (1dqa B:587-703)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561250Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) (S)
  5. 2561251Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein)
  6. 2561252Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species)
  7. 2561253Species Human (Homo sapiens) [TaxId:9606] [55038] (9 PDB entries)
  8. 2561255Domain d1dqab1: 1dqa B:587-703 [39365]
    Other proteins in same PDB: d1dqaa4, d1dqab4, d1dqac4, d1dqad4
    complexed with coa, mah, nap

Details for d1dqab1

PDB Entry: 1dqa (more details), 2 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with hmg, coa, and nadp+
PDB Compounds: (B:) protein (hmg-coa reductase)

SCOPe Domain Sequences for d1dqab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqab1 d.58.20.1 (B:587-703) NAD-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
gmtrgpvvrlpracdsaevkawletsegfavikeafdstsrfarlqklhtsiagrnlyir
fqsrsgdamgmnmiskgtekalsklheyfpemqilavsgnyctdkkpaainwiegrg

SCOPe Domain Coordinates for d1dqab1:

Click to download the PDB-style file with coordinates for d1dqab1.
(The format of our PDB-style files is described here.)

Timeline for d1dqab1: