![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
![]() | Protein automated matches [276200] (4 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries) |
![]() | Domain d6yez4_: 6yez 4: [393647] Other proteins in same PDB: d6yeza_, d6yezb_, d6yezc_, d6yezd_, d6yeze1, d6yeze2, d6yezf_, d6yezj_, d6yezn_, d6yezp_ automated match to d5l8r4_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, cu, dgd, fes, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 6yez (more details), 2.7 Å
SCOPe Domain Sequences for d6yez4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yez4_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} kkgewlpglaspgyltgslpgdngfdplglaedpenlkwfvqaelvngrwamlgvagmll pevftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpi fkqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfd nllqhisdpwhntivqtl
Timeline for d6yez4_: